<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07453
| Description |
Uncharacterized protein |
| Sequence | MATMTKRPRLTGSQDLLSYYNLTPLYDKYVRPYSPPNRAAGLDQTLFRYISDLPGKYDVEPDGYLINLLRDPQAVESGPKIKRLDPETLEDAFSLKEGPVPGFDASILGTDDGGSSTYSGVNPGQYLHTERGEYGASAGDEMNKRERKKKKKKRKHSHDHDEDGHTHEHKKKKKRKKASVG |
| Length | 181 |
| Position | Head |
| Organism | Phycomyces blakesleeanus (strain ATCC 8743b / DSM 1359 / FGSC 10004 / NBRC 33097 / NRRL 1555) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Fungi incertae sedis> Mucoromycota> Mucoromycotina>
Mucoromycetes> Mucorales> Phycomycetaceae> Phycomyces.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -1.156 |
| Instability index | 39.11 |
| Isoelectric point | 9.27 |
| Molecular weight | 20391.59 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP07453
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.67| 18| 19| 140| 157| 1
---------------------------------------------------------------------------
140- 157 (32.64/19.54) DEMNK.RERKKKKKKRKHS
161- 179 (29.03/16.69) DEDGHtHEHKKKKKRKKAS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.56| 14| 18| 68| 85| 2
---------------------------------------------------------------------------
54- 67 (23.44/ 6.67) PGKYDVEPDGYLIN
72- 85 (22.12/14.25) PQAVESGPKIKRLD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.05| 16| 19| 98| 116| 3
---------------------------------------------------------------------------
98- 116 (26.05/20.98) GPVPGfdaSILGTDDG..GSS
120- 137 (27.00/13.68) GVNPG...QYLHTERGeyGAS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.55| 11| 27| 9| 19| 4
---------------------------------------------------------------------------
9- 19 (19.55/13.44) RLTG.SQDLLSY
38- 49 (16.00/ 9.86) RAAGlDQTLFRY
---------------------------------------------------------------------------
|