Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MQRFAATEDLTSVEWRDTNWLERVGGFQNQQMVLDYFAMSPFWDRQCNNQVLSMQTQYNDLRQPYEATVEALRKMTGIEFAVIHEQPPVWVIQKRYRRGPAPDDANVYQSPTIYSVIANRLLTSLFHVNSAFKETQAMMEFHPAKGYSWKANNSTNEKQPVTAIPEKTRGPQPSKLRAQENQAFRHWMDRAIEASAARIAQTRHSLDSQSVEGSSQGSKTATKIEPGSTSAITQQRDDSTGKRQRKKTDDGNSMTNKRKKKAGKQT |
Length | 266 |
Position | Head |
Organism | Phycomyces blakesleeanus (strain ATCC 8743b / DSM 1359 / FGSC 10004 / NBRC 33097 / NRRL 1555) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Fungi incertae sedis> Mucoromycota> Mucoromycotina> Mucoromycetes> Mucorales> Phycomycetaceae> Phycomyces. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.938 |
Instability index | 45.06 |
Isoelectric point | 9.68 |
Molecular weight | 30377.65 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP07449 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 62.85| 17| 69| 85| 102| 1 --------------------------------------------------------------------------- 85- 102 (30.25/23.57) EQPPVWVIQKRyRRGPAP 157- 173 (32.60/19.85) EKQPVTAIPEK.TRGPQP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) GKRQRKKTDD 2) SMTNKRKKKAGKQT | 241 253 | 250 266 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab