<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07422
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MEGSHRRNLPGGYLTPSPGSQDPDSPIPPFVNPGPGYDELVSETDGDADHIFTNNITDTMEEQDGASLSSTFPNPPPFWRDFTADKVARYEQLRNEYDEDEAEKTAADENYKPQSRIPNLPEELMHLQPPDEPADGRWRVFGDQYMLDDQLPTLEEQGITNLPASGQSSARDAKHYDRAFELKRLAKSLLLNFLELTGALSRSPSHAEAKVQDLRTLFINVHHILNEYRPHQARESAIEMMQDHLDRTRTETLAIRTQVDKAKRLLEGLGSLGLGGDTAGAGAAGAGAQQTAEKKEKNSGGDGVAAAAAEAANGADVDWERERQIWASVDDLFS |
| Length | 334 |
| Position | Middle |
| Organism | Beauveria brongniartii RCEF 3172 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Cordycipitaceae> Beauveria>
Beauveria brongniartii.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.788 |
| Instability index | 51.78 |
| Isoelectric point | 4.65 |
| Molecular weight | 36778.86 |
| Publications | PubMed=27071652
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP07422
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 141.21| 39| 57| 1| 39| 1
---------------------------------------------------------------------------
1- 39 (74.89/35.71) MEGSHRRNLPGGYLTPSPGSQD.PDSPIPPFVNPGPGYDE
60- 99 (66.32/30.93) MEEQDGASLSSTFPNPPPFWRDfTADKVARYEQLRNEYDE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 76.48| 23| 24| 275| 297| 2
---------------------------------------------------------------------------
275- 297 (39.90/25.62) GGDTAGAGAAGA..GAQQTAEKKEK
300- 324 (36.58/22.87) GGDGVAAAAAEAanGADVDWERERQ
---------------------------------------------------------------------------
|