Description | Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MEKPNALGISADEFKAIEQTRQRLFQLSNSIQGLKVDVLKSNPLPPPSSLQAQSQILLRNLQSLLETLTENTHVFQHLHVFPDVAYPGRVHENILLQLLRKKLEPGVEEWVERGREATRELRASSSEGGGAGEAGLEDVWRGVREWTVERVQRYVLEEAGDVYTEEERERGVENVRTGLTRSLEDDEDDDEEESDEEGGGGEDGDVVMSGQGQKQQAKQPKPTGPEPEMLFWFEARGDFDLPRNVDLLSQAGTKRGPMGARK |
Length | 262 |
Position | Head |
Organism | Colletotrichum tofieldiae |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Glomerellales> Glomerellaceae> Colletotrichum> Colletotrichum spaethianum species complex. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.821 |
Instability index | 50.55 |
Isoelectric point | 4.72 |
Molecular weight | 29371.16 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP07414 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 140.03| 32| 35| 106| 139| 1 --------------------------------------------------------------------------- 106- 139 (52.33/29.05) GVEEW.VERGREATRElrASSSEGGG.....AGEAGLEDV 142- 175 (38.20/15.96) GVREWtVERVQRYVLE......EAGDvyteeERERGVENV 178- 206 (49.50/22.58) GLTRS.LEDDEDDDEE..ESDEEGGG......GEDG..DV --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 38.76| 12| 37| 55| 66| 2 --------------------------------------------------------------------------- 55- 66 (19.51/14.20) QILLRNLQSLLE 93- 104 (19.24/13.92) NILLQLLRKKLE --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) MGARK 2) QGQKQQAKQPKPTGPEPEMLFWFEARGDFDLPRNVDLLSQA | 258 211 | 262 251 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab