<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07407
| Description |
Serine/threonine-protein kinase SSN3 |
| Sequence | MWRGIGYGGLHSHSSYPADRGLGHINYQPKVRVIERYKVVGFISSGTYGRVYKALGRQGQTGEFAIKKFKPDKEGEQISYTGISQSAIREMSLCSELKHANVIKLIEIILEDKCIFMVFEYAEHDLLQIIHHHTQNPRHPIPPQTVKSIMFQLLNGCQYLHANWVLHRDLKPANIMVTSAGEVKIGDLGLARRFDKPLHSLFSGDKVVVTIWYRAPELILGSRHYTPAIDMWAVGCIFAELLSLRPIFKGEEAKMDSKKTVPFQRNQMQKIVDIMGLPSKERWPLLTAMPEYPQLSTLQPPMTPHHHGHHGHHRGHGYGHHPPAPSGSNLEKWYYSTISQGASSSATSAPQSNGAPLASLGAEGYKLLASLLEYDPVERLTAAKALQHPFFSTGDRLNAHCFEGLKNEYPHRRVSQDDNDIRTSSLPGTKRSGLPDDSLARPVKKLREV |
| Length | 449 |
| Position | Kinase |
| Organism | Colletotrichum tofieldiae |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Glomerellales> Glomerellaceae> Colletotrichum>
Colletotrichum spaethianum species complex.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.429 |
| Instability index | 37.38 |
| Isoelectric point | 9.24 |
| Molecular weight | 50378.10 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP07407
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.71| 20| 119| 114| 144| 1
---------------------------------------------------------------------------
120- 139 (39.03/39.38) EYAEHDLLQ...IIHHHTQNPRH
291- 313 (36.68/10.42) EYPQLSTLQppmTPHHHGHHGHH
---------------------------------------------------------------------------
|