<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07390

Description Uncharacterized protein
SequenceMLGPSDKDAAKNKLVAIAIDRDKGSQGAMKWAVEYILSKGQNILLVHVKARSSNSATSVASSKSSQVSDFDDETGSASGDADCKDVFRPFRAFCTRKDINCHDVLLEDNDVSRGIVQYVTETAIEILVIGAGSKGGFFRFNKKDIPGSVSKGIPDFCTIYVISKGKISSTRAASRPVPFISPIRSQILHQPSTRTESEISIPIPNSAKAELTKFVFHRSPFARRGRNSIDLDLSFNSSGRPSTDRLYPSFDSFETSSTPRLSNFSNFSDLDNPAFEPFQNERRSMDDRRSMDTFTTELSYASGDSDILGSSPTLNMNTDIGLGLRIIQFKDDLESEMKRLKLELKQTMDMYSTACKEALTAKQKAMELQRWKMEETQRLEEARIAEEHAMALAEREKARSKAAIEHAEAAQRLAEIEAKKRVTAEMKSLKESGEKDETMTSVAKTDLRYRKYTIEEIEEATEFFAKSRKIGEGGYGPVYKCYLDHTPAAVKVLRPDAAQGRSQFHQEVEILSCMRHPNMVLLLGACPEYGCLVYEYMSNGSLEDRLLQKGNTKPLSWQHRFRIAAEIGTGLLFLHQTKPEPLVHRDLKPGNILLDRNFVGKISDVGLARLVPPTVADSVTQYRMTSTAGTFCYIDPEYQQTGMLGVKSDVYSLGIMYLQIITAKPPMGLTHIVEKAIENGTFHEILDQSVPDWPVEEALSFAKISLQCAELRRKDRPDLGTVVLPELERLRDLAEDNMTDAMLYGTGLSPNQSQASMSQMSYPQSGYTSDSITSTGPDS
Length779
PositionTail
OrganismDaucus carota subsp. sativus (Carrot)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> campanulids> Apiales> Apiaceae> Apioideae> Scandiceae> Daucinae> Daucus> Daucus sect. Daucus.
Aromaticity0.07
Grand average of hydropathy-0.444
Instability index51.07
Isoelectric point5.99
Molecular weight86696.26
Publications
PubMed=27158781

Function

Annotated function 
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:InterPro
protein kinase activity	GO:0004672	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP07390
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      59.77|      21|      23|     361|     382|       1
---------------------------------------------------------------------------
  361-  381 (37.91/26.11)	AKQKAMEL.QRWK.........MEETQRLEE
  385-  415 (21.87/ 7.79)	AEEHAMALaEREKarskaaiehAEAAQRLAE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      44.19|      14|      62|     223|     239|       2
---------------------------------------------------------------------------
  223-  239 (20.50/16.04)	RRGRNSIDldlSFNSSG
  244-  257 (23.68/10.89)	DRLYPSFD...SFETSS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      85.80|      20|      23|     159|     178|       3
---------------------------------------------------------------------------
  126-  146 (28.15/13.98)	I..LVIGAGsKGGFFRFNKKDIP
  159-  178 (31.66/16.52)	I..YVISKG.KISSTRAASRPVP
  183-  204 (25.99/12.41)	IrsQILHQP.STRTESEISIPIP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.37|      15|      24|      85|      99|       4
---------------------------------------------------------------------------
   85-   99 (28.13/16.33)	DVFRPFRAFCTRKDI
  110-  124 (25.25/13.99)	DVSRGIVQYVTETAI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.11|      17|      86|     327|     359|       5
---------------------------------------------------------------------------
  308-  324 (28.95/34.95)	LGSSPTLNM.NTDIGLGL
  342-  359 (24.15/10.56)	LELKQTMDMySTACKEAL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      50.18|      15|      86|     327|     341|       6
---------------------------------------------------------------------------
  327-  341 (25.91/19.14)	IQFKDDLESEMKRLK
  416-  430 (24.27/17.45)	IEAKKRVTAEMKSLK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      46.83|      13|      36|     258|     270|       7
---------------------------------------------------------------------------
  258-  270 (24.07/17.68)	TPRLSNFSNFSDL
  295-  307 (22.76/16.26)	TTELSYASGDSDI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     140.85|      43|     471|       3|      45|       8
---------------------------------------------------------------------------
    3-   45 (72.49/44.60)	GPSDKDAAKNKLVAIAIDRDKGSQGAMKWAVEY.ILS..KGQNILL
  476-  521 (68.36/41.69)	GPVYKCYLDHTPAAVKVLRPDAAQGRSQFHQEVeILScmRHPNMVL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     187.33|      55|     109|     541|     595|       9
---------------------------------------------------------------------------
  541-  595 (96.61/69.17)	SLEDRLLQKGNTK.PLSWQHRFRIAAEIGTGLLFLHQTKPEPLVHRDLKPGNILLD
  652-  707 (90.72/64.51)	SLGIMYLQIITAKpPMGLTHIVEKAIENGTFHEILDQSVPDWPVEEALSFAKISLQ
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP07390 with Med32 domain of Kingdom Viridiplantae
Unable to open file!