<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07380
| Description |
Uncharacterized protein |
| Sequence | MDIDEFRRILSDSAVDIWSFIDTAIAVASSDYGEELKDRRDEIVQRLYACRNCGDQVNEHRRIVEPVVKVDNSQAKLKHSPYTPQSVHREEDVDVVNDDEEEDPYAGLFDDDEETRILRIKDQIEDPDQTEESLVELLQGLADMDITFKGLKETDIGRYVNRLRKHESNEVRRLVKQLVRKWKDLVDEWVKLNPPEIPSSTIIADGESPPMNMRRNLPNGHQVPDFAYSPNPNNGSSGSERNNSEPEQKPKSVPRRELVAKPTYRPTAGSASAPPLNRPHKETAIDPDRLASARKRLHENYQEAQNAKKQRTIQVMDIHEIPKPKNGYIAKNKGGFHGRNHR |
| Length | 342 |
| Position | Unknown |
| Organism | Daucus carota subsp. sativus (Carrot) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Apiales> Apiaceae> Apioideae> Scandiceae> Daucinae>
Daucus> Daucus sect. Daucus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.018 |
| Instability index | 49.97 |
| Isoelectric point | 5.69 |
| Molecular weight | 39208.17 |
| Publications | PubMed=27158781
|
Function
| Annotated function |
|
| GO - Cellular Component | cytosol GO:0005829 IEA:EnsemblPlants
nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP07380
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 36.96| 11| 20| 99| 117| 1
---------------------------------------------------------------------------
99- 114 (15.51/27.24) DEEEDPyaglfDDDEE
122- 132 (21.45/ 7.87) DQIEDP.....DQTEE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.39| 17| 19| 28| 45| 2
---------------------------------------------------------------------------
28- 45 (23.74/18.72) ASSDYGEELKDRRdEIVQ
49- 65 (31.65/19.98) ACRNCGDQVNEHR.RIVE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.44| 17| 19| 196| 212| 4
---------------------------------------------------------------------------
196- 212 (31.24/17.59) EIPSSTIIAD.GESP.PMN
216- 234 (25.21/12.93) NLPNGHQVPDfAYSPnPNN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.62| 13| 23| 250| 262| 5
---------------------------------------------------------------------------
250- 262 (22.50/13.18) PKSVPRRELVAKP
275- 287 (24.11/14.61) PLNRPHKETAIDP
---------------------------------------------------------------------------
|