<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07351
Description |
Uncharacterized protein |
Sequence | MADAVPQSDVSRPSALPTANLLQRPTVPLVDQNSNEYLDSIEEEWNKKVDVEIDTLVDGMVDLVGLASIGDKDKFRIAQEAYQAECRAESMIRAAHSLLSIIHSMKLLLLLSDESQIANRRDAEMRDVQEEKDLLKKQVAEKLDEILHPGRPHKQPASQ |
Length | 159 |
Position | Head |
Organism | Daedalea quercina L-15889 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Polyporales> Daedalea.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.478 |
Instability index | 52.14 |
Isoelectric point | 4.83 |
Molecular weight | 17824.00 |
Publications | PubMed=26659563
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP07351
No repeats found
|