<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07348
| Description |
Uncharacterized protein |
| Sequence | MSNIVQVVTGAPANVPNQPGTQQVQTQYEVILFGEFVNEKGRLDAILNRLSLVSDGGATRIQFAEWHFEPHQRVEGADPVALMARREKGATSWVLHSHLKPESTRVHPDATVRAATYCTIEGHALDFVSALGFRLRFKLHKRGYVFRRGPLTITMLQLDQIDTKTRKNVAPHASAPWQVECRAYTKDVPLQQAIDAVLELQLIVKGWLDLARQE |
| Length | 214 |
| Position | Head |
| Organism | Exidia glandulosa HHB12029 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Auriculariales> Exidiaceae> Exidia.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.261 |
| Instability index | 36.26 |
| Isoelectric point | 8.95 |
| Molecular weight | 24041.23 |
| Publications | PubMed=26659563
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP07348
No repeats found
|