Description | Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MGYTTLARWINTNGAGLDMLRDSIMKNHMGQFRGRWQLIIKAYRSSLSSVLGFNHNYERIMWTMTMPANDVSFVLIEDPMVASRAEHDAKPDGDPADETPPHYRNTLVTLSPAAALDQLLVQTKAPWVRSGQPTVVVDGAIFAIGTDWIVRAGNVMMPGGAVKGLLLEAEYLPLPNQASASNQTSELFSNFLTSLLPAVPDAKTVAVAVSDQEWHEVLCPEAEDPSDEQEPTVEDDDVYAHGFPEPKSNDWTGIDRDRRSAFMIQGVLRSEGLL |
Length | 274 |
Position | Head |
Organism | Exidia glandulosa HHB12029 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes> Auriculariales> Exidiaceae> Exidia. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.251 |
Instability index | 41.46 |
Isoelectric point | 4.66 |
Molecular weight | 30211.73 |
Publications | PubMed=26659563 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP07347 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 55.04| 15| 24| 27| 42| 1 --------------------------------------------------------------------------- 27- 42 (24.32/17.24) NHMGQfRGRWQLIIKA 54- 68 (30.72/16.98) NHNYE.RIMWTMTMPA --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 41.71| 11| 127| 91| 101| 2 --------------------------------------------------------------------------- 91- 101 (23.70/13.23) PDG.DPADETPP 220- 231 (18.01/ 8.46) PEAeDPSDEQEP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 54.11| 15| 18| 127| 141| 3 --------------------------------------------------------------------------- 127- 141 (26.41/14.46) WVRSGQPTVVVDGAI 148- 162 (27.70/15.46) WIVRAGNVMMPGGAV --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DVYAHGF 2) WTGIDRDRRSA | 237 251 | 243 261 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab