<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07347
| Description |
Mediator of RNA polymerase II transcription subunit 20 |
| Sequence | MGYTTLARWINTNGAGLDMLRDSIMKNHMGQFRGRWQLIIKAYRSSLSSVLGFNHNYERIMWTMTMPANDVSFVLIEDPMVASRAEHDAKPDGDPADETPPHYRNTLVTLSPAAALDQLLVQTKAPWVRSGQPTVVVDGAIFAIGTDWIVRAGNVMMPGGAVKGLLLEAEYLPLPNQASASNQTSELFSNFLTSLLPAVPDAKTVAVAVSDQEWHEVLCPEAEDPSDEQEPTVEDDDVYAHGFPEPKSNDWTGIDRDRRSAFMIQGVLRSEGLL |
| Length | 274 |
| Position | Head |
| Organism | Exidia glandulosa HHB12029 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Auriculariales> Exidiaceae> Exidia.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.251 |
| Instability index | 41.46 |
| Isoelectric point | 4.66 |
| Molecular weight | 30211.73 |
| Publications | PubMed=26659563
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP07347
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.04| 15| 24| 27| 42| 1
---------------------------------------------------------------------------
27- 42 (24.32/17.24) NHMGQfRGRWQLIIKA
54- 68 (30.72/16.98) NHNYE.RIMWTMTMPA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.71| 11| 127| 91| 101| 2
---------------------------------------------------------------------------
91- 101 (23.70/13.23) PDG.DPADETPP
220- 231 (18.01/ 8.46) PEAeDPSDEQEP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.11| 15| 18| 127| 141| 3
---------------------------------------------------------------------------
127- 141 (26.41/14.46) WVRSGQPTVVVDGAI
148- 162 (27.70/15.46) WIVRAGNVMMPGGAV
---------------------------------------------------------------------------
|