| Description | Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MDDDELEGELRNPFPSPPSHYTRFTSQNLKLLSLLKTRVENGDAAPDDRQTTVLADQKDVPDWDLRLLEPPRVDWMLEDGEYSAFGDTWKLKEEVESLAKAGGTQLFPEDPSVDRRPHLKSILRTLLSSYTQLLDAVVQPPPTTSMGGDAAVPEWQAHLQWMHTMGQNLMAAANELRPAQARVNLEGMMRRQVELRREETKMIHEKCDTLERTLAALQQRTVSSLASTEPKASVEDTSASHPFFGYPHDAMDLEVLPLVNQDVLAWADAID |
| Length | 271 |
| Position | Middle |
| Organism | Exidia glandulosa HHB12029 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes> Auriculariales> Exidiaceae> Exidia. |
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.569 |
| Instability index | 48.87 |
| Isoelectric point | 4.72 |
| Molecular weight | 30526.95 |
| Publications | PubMed=26659563 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP07346
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 174.62| 51| 91| 14| 67| 1
---------------------------------------------------------------------------
14- 67 (86.20/48.70) FPSPPSHYTRftsQNLK..LLSLLKTRVENGDAAPDDRQTTVLADQKDVPDWDLRL
107- 159 (88.41/43.85) FPEDPSVDRR...PHLKsiLRTLLSSYTQLLDAVVQPPPTTSMGGDAAVPEWQAHL
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) HYTRFTSQNLKLLSLL 2) MDDDELEGEL 3) WDLRLL | 20 1 63 | 35 10 68 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab