Description | Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MDDDELEGELRNPFPSPPSHYTRFTSQNLKLLSLLKTRVENGDAAPDDRQTTVLADQKDVPDWDLRLLEPPRVDWMLEDGEYSAFGDTWKLKEEVESLAKAGGTQLFPEDPSVDRRPHLKSILRTLLSSYTQLLDAVVQPPPTTSMGGDAAVPEWQAHLQWMHTMGQNLMAAANELRPAQARVNLEGMMRRQVELRREETKMIHEKCDTLERTLAALQQRTVSSLASTEPKASVEDTSASHPFFGYPHDAMDLEVLPLVNQDVLAWADAID |
Length | 271 |
Position | Middle |
Organism | Exidia glandulosa HHB12029 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes> Auriculariales> Exidiaceae> Exidia. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.569 |
Instability index | 48.87 |
Isoelectric point | 4.72 |
Molecular weight | 30526.95 |
Publications | PubMed=26659563 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP07346 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 174.62| 51| 91| 14| 67| 1 --------------------------------------------------------------------------- 14- 67 (86.20/48.70) FPSPPSHYTRftsQNLK..LLSLLKTRVENGDAAPDDRQTTVLADQKDVPDWDLRL 107- 159 (88.41/43.85) FPEDPSVDRR...PHLKsiLRTLLSSYTQLLDAVVQPPPTTSMGGDAAVPEWQAHL --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) HYTRFTSQNLKLLSLL 2) MDDDELEGEL 3) WDLRLL | 20 1 63 | 35 10 68 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab