| Description | Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MFYDKQSNNQVLRMQTIHTGVALKNEAEELRRFTGIEFAVVKSEPPTLFVIQKRNRLSPDEAQPLVAYFILQNRIYQAPDVYSVISNRLLTTLHALQASLETIRSHRPNFTPRLGFVWPIVDNSPASQGAGDSATQRKNRSSAEPPDTGVAEQQSDEPVPAVPSTSAVASKKAVNLNPLFLAMRTTAGHASTTFVPHFRDATAPAGAPEPAAPPSASPAPPGPATRAGSTDAPPPKKKRKKTTAAATPSLS |
| Length | 251 |
| Position | Head |
| Organism | Exidia glandulosa HHB12029 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes> Auriculariales> Exidiaceae> Exidia. |
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.444 |
| Instability index | 60.00 |
| Isoelectric point | 9.88 |
| Molecular weight | 26951.12 |
| Publications | PubMed=26659563 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP07342
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 141.00| 40| 74| 119| 160| 1
---------------------------------------------------------------------------
119- 160 (65.63/30.51) PIVDNSPASQGAGDSATQrkNRSSAEPPDTGVAEQQSDEPVP
196- 235 (75.37/31.25) PHFRDATAPAGAPEPAAP..PSASPAPPGPATRAGSTDAPPP
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) FVPHFRD 2) PLFLAMR 3) RAGSTDAPPPKKKRKKTTAAATPSLS | 194 178 226 | 200 184 251 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab