Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MSSILVEPLYQLQALSQQLFLSLGPAQSKPPPAPPVSAFLAVDATLAAAVQCARAHQVRQRRIEALKTEILGLEGEWRNVVDSLEEGRKELEQMVKEGEERLKAIEDAKQAAIPYPELLAYAQSLSAFTSAPPNMPDLTLPGQPPPPLFFPPFPNEEKMRRGHMNDEAPLGLLGETHSVGKAPTVQPKSVEHPDHLMGPGANPYRPDLRAPQQQFFDLDLDLNPDL |
Length | 226 |
Position | Middle |
Organism | Daedalea quercina L-15889 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes> Polyporales> Daedalea. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.405 |
Instability index | 61.29 |
Isoelectric point | 4.99 |
Molecular weight | 24845.06 |
Publications | PubMed=26659563 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP07340 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 76.53| 15| 113| 21| 35| 1 --------------------------------------------------------------------------- 21- 35 (31.95/13.71) LSLGPAQSKPPPA...PP 124- 137 (21.69/ 7.15) .SLSAFTSAPPNM...PD 138- 152 (22.90/ 7.92) LTL.PGQ..PPPPlffPP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) QQQFFDLDLDLN 2) YRPDLRA | 212 204 | 223 210 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab