<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07324
| Description |
Mediator of RNA polymerase II transcription subunit 8 |
| Sequence | MTSLDAADLKALEQTRQRLFQLTSSLASLQQSIHMSDPLPPWNSLQSLATIISQHLATLSAHLTTHHDLLSSTIVYPLPTFPGRTEESLLGQLLRKKLEPAVEDWVDRGREIATEALGNGNNQSANGQTSGDHAQPSATVGGLPDPTSSASSSRLTEKELDSLWDWARVAANEEARARDWDADYTREEQESGIQNVITGLRRKLRDPDEESSDEEDNEEAIAGDEDEERNIPDDEMEVVGVRRKSGAAGLEFQLRRESEHRAAMMAKKPSLPMTEVFRFMHTGAEPRGVGAEPFGPLGMAGVRR |
| Length | 304 |
| Position | Head |
| Organism | Xylona heveae (strain CBS 132557 / TC161) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Xylonomycetes>
Xylonales> Xylonaceae> Xylona.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.682 |
| Instability index | 57.48 |
| Isoelectric point | 4.81 |
| Molecular weight | 33488.62 |
| Publications | PubMed=26693682
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP07324
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 205.76| 58| 59| 93| 151| 1
---------------------------------------------------------------------------
60- 87 (22.62/ 7.28) ...............................SAHLTTHHD.LLSSTIVYPLPTfPGRTEE
93- 151 (90.96/53.82) LLRKKLEpAVEDWVDRGREIATEALGNGNNQSANGQTSGDHAQPSATVGGLPD.PTSSAS
155- 212 (92.18/50.25) LTEKELD.SLWDWARVAANEEARARDWDADYTREEQESGIQNVITGLRRKLRD.PDEESS
---------------------------------------------------------------------------
|