<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07315
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MSVLDGDIQHLPMRDALQQHLDRLSELSFALFSSLSALSPTHAHPSSHSLQASHSRPAPEASAFLALDQSFASALRFARVHQLRWERIERLRREVARLEEEMRGVLGVLEEGEEALEGVVEEGEEELGAIKRAKDNPIPYAELMAYASHLSAYTSLPPSFPPYRLPQHPGEEGEKPLHLYAPTQEMLRRGRLNAEGVGMSIAGEEGAVGVPQDHPPLPEAGHQEQPIAPTRPARPAAAEVFNDLDLNLDL |
| Length | 250 |
| Position | Middle |
| Organism | Calocera cornea HHB12733 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Dacrymycetes>
Dacrymycetales> Dacrymycetaceae> Calocera.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.442 |
| Instability index | 66.10 |
| Isoelectric point | 5.08 |
| Molecular weight | 27524.57 |
| Publications | PubMed=26659563
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP07315
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.35| 15| 49| 165| 184| 1
---------------------------------------------------------------------------
165- 184 (15.63/22.31) LPQhPGEEgEKPLhlyAPTQ
217- 231 (29.73/14.40) LPE.AGHQ.EQPI...APTR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.53| 19| 31| 1| 20| 6
---------------------------------------------------------------------------
1- 20 (31.27/18.73) MSVLDGDIQHlPMRDALQ.QH
35- 54 (30.26/14.17) LSALSPTHAH.PSSHSLQaSH
---------------------------------------------------------------------------
|