<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07312
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MAPPEPPVDPVRESNRARFEIELEFVQALASPFYLETLAQRGYFQQEEFVNYLKYLLYWKKREYARFLAYPQALHHLELLQEDAFRKALSNHNVIVALDNQQYQHWRTWYDSIFVDGATSDHACRRNNPAMQPRMSSAPPTARQPTAAAPKPAPPGAPPPQPGDDGAASTT |
Length | 171 |
Position | Middle |
Organism | Calocera cornea HHB12733 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Dacrymycetes>
Dacrymycetales> Dacrymycetaceae> Calocera.
|
Aromaticity | 0.12 |
Grand average of hydropathy | -0.667 |
Instability index | 65.31 |
Isoelectric point | 6.20 |
Molecular weight | 19481.63 |
Publications | PubMed=26659563
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP07312
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.31| 15| 15| 120| 134| 1
---------------------------------------------------------------------------
120- 134 (29.11/14.14) SDHACRRNNPAMQPR
137- 151 (26.19/12.12) SAPPTARQPTAAAPK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.65| 12| 22| 15| 27| 2
---------------------------------------------------------------------------
15- 27 (17.30/14.17) NRARFEIElEFVQ
40- 51 (23.34/14.26) QRGYFQQE.EFVN
---------------------------------------------------------------------------
|