Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MSQAEDPRASNRARFELELEFVQSLANPYYLHSLAQQNVLNQPAFINFLKYLQYWKEPQYARFIHYPHALHHLELLQYERFRTEIGKDEWREYLNQNQFDHWRTW |
Length | 105 |
Position | Middle |
Organism | Laetiporus sulphureus 93-53 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes> Polyporales> Laetiporus. |
Aromaticity | 0.18 |
Grand average of hydropathy | -0.873 |
Instability index | 38.22 |
Isoelectric point | 6.28 |
Molecular weight | 13073.45 |
Publications | PubMed=26659563 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
Binary Interactions |
Repeats | >MDP07305 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 64.31| 18| 28| 11| 28| 3 --------------------------------------------------------------------------- 11- 28 (29.89/16.55) NRARFELELEFVQSLANP 41- 58 (34.42/19.92) NQPAFINFLKYLQYWKEP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DPRASNRARFELELEF 2) PYYLH 3) WREYLN | 6 28 90 | 21 32 95 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab