<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07291
| Description |
Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MSAPSPLPAPHARSPAPSAPQTPGASSPDDSSDSDAAPYTPFTPGDSALSPGASPTTPSAPRFGLKASDRRRPEGTLGKVELLLEGLAEELNTLQTRAEAVYAPRREEDGPLIQATVREVVDSLVQLDELAPLLEEWVPVQVLEYLDEGRNPDDYTRTMLELTAAENQFTNGKVHAVHSYLQHLSAGLADAFPAMAPYVPPPQIPLSDGDGEPAQEKERELRSHVQAVEQPPDGGVGKVDAVAVGAGISGSGDAQEGQGGESAEGEPLDVGMEVDLPPASGPPAQEAA |
| Length | 288 |
| Position | Middle |
| Organism | Calocera cornea HHB12733 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Dacrymycetes>
Dacrymycetales> Dacrymycetaceae> Calocera.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.487 |
| Instability index | 57.07 |
| Isoelectric point | 4.26 |
| Molecular weight | 29995.60 |
| Publications | PubMed=26659563
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP07291
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 77.99| 14| 15| 28| 41| 1
---------------------------------------------------------------------------
10- 23 (27.38/12.50) PHARSPA.PSAPQTP
28- 41 (29.17/13.82) PDDSSDS.DAAPYTP
44- 58 (21.45/ 8.11) PGDSALSpGASPTTP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 188.62| 58| 60| 120| 177| 2
---------------------------------------------------------------------------
120- 177 (96.24/42.67) VVDSL.VQLDELAPLLEEWVPVQVLEYLD.EGRNPDDYTRTMLELTAAENQFTNGKVHAV
180- 239 (92.38/40.72) YLQHLsAGLADAFPAMAPYVPPPQIPLSDgDGEPAQEKERELRSHVQAVEQPPDGGVGKV
---------------------------------------------------------------------------
|