Description | Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MSAPSPLPAPHARSPAPSAPQTPGASSPDDSSDSDAAPYTPFTPGDSALSPGASPTTPSAPRFGLKASDRRRPEGTLGKVELLLEGLAEELNTLQTRAEAVYAPRREEDGPLIQATVREVVDSLVQLDELAPLLEEWVPVQVLEYLDEGRNPDDYTRTMLELTAAENQFTNGKVHAVHSYLQHLSAGLADAFPAMAPYVPPPQIPLSDGDGEPAQEKERELRSHVQAVEQPPDGGVGKVDAVAVGAGISGSGDAQEGQGGESAEGEPLDVGMEVDLPPASGPPAQEAA |
Length | 288 |
Position | Middle |
Organism | Calocera cornea HHB12733 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Dacrymycetes> Dacrymycetales> Dacrymycetaceae> Calocera. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.487 |
Instability index | 57.07 |
Isoelectric point | 4.26 |
Molecular weight | 29995.60 |
Publications | PubMed=26659563 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP07291 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 77.99| 14| 15| 28| 41| 1 --------------------------------------------------------------------------- 10- 23 (27.38/12.50) PHARSPA.PSAPQTP 28- 41 (29.17/13.82) PDDSSDS.DAAPYTP 44- 58 (21.45/ 8.11) PGDSALSpGASPTTP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 188.62| 58| 60| 120| 177| 2 --------------------------------------------------------------------------- 120- 177 (96.24/42.67) VVDSL.VQLDELAPLLEEWVPVQVLEYLD.EGRNPDDYTRTMLELTAAENQFTNGKVHAV 180- 239 (92.38/40.72) YLQHLsAGLADAFPAMAPYVPPPQIPLSDgDGEPAQEKERELRSHVQAVEQPPDGGVGKV --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AVGAGI 2) FGLKA 3) QGGESAEGEPLDVGMEVDLPPAS | 243 63 258 | 248 67 280 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab