<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07274
| Description |
Cyclin domain-containing protein |
| Sequence | MAGNFWTSTQHLHWQFSKPGLAEIRRKLEQEDRALVQQYPLPDRRLLSIYFYHQIGKLGKRLTIRQQALATAQVYIRRFYTKVEIRRTNPYLVLVTALYLACKMEECPQHIRLVVAEARNIWPDFISSDTSKLGECEFFLISEMRSQLIIHQPYRTLLTLHSSFSMTQDEINLAWSVINDHYLTDLPLLYPPHVIAVAAIFLAVVLKPAQASLHGSNGSAAAPTSIAQAMTGTPNRYAQQFPATNTQQIGSSGAAPQNKVQYLVNWLAESDVDMEAVIDCTQEIISLYEVWEQYNDKVCKEQITRFVKARGLDK |
| Length | 314 |
| Position | Kinase |
| Organism | Xylona heveae (strain CBS 132557 / TC161) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Xylonomycetes>
Xylonales> Xylonaceae> Xylona.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.174 |
| Instability index | 42.98 |
| Isoelectric point | 8.20 |
| Molecular weight | 35874.78 |
| Publications | PubMed=26693682
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP07274
No repeats found
|