<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07271
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MATSTFPPPPPFYRLYKDYIQDPQSAPEPPPPIQGTYVLFGANYTTDDALPSLEEQGVRQLYPKGPNVVGHADVQHCTLILDFKKELKSLNRELQLHILELADILVERPSQYARKVEDISLIFKNMHHLLNSLRPHQARATLIHMLELQIQRRKQAVEDIKRRREEAQRILKEALAKLDGQ |
| Length | 181 |
| Position | Middle |
| Organism | Daucus carota subsp. sativus (Carrot) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Apiales> Apiaceae> Apioideae> Scandiceae> Daucinae>
Daucus> Daucus sect. Daucus.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.544 |
| Instability index | 67.11 |
| Isoelectric point | 7.88 |
| Molecular weight | 20877.79 |
| Publications | PubMed=27158781
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP07271
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.61| 20| 24| 18| 41| 2
---------------------------------------------------------------------------
18- 40 (33.76/31.47) DYIQDPQSapePPPPIQGTYVLF
43- 62 (34.85/17.87) NYTTDDAL...PSLEEQGVRQLY
---------------------------------------------------------------------------
|