<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07270
Description |
Uncharacterized protein |
Sequence | MDHESKNFGRGPRERTGAVDLINQYKLLPHHEFFCKRSLPLSISDTHYLHNVVGDAEIRKGEGMQLDQLVQSTSYPRESNVRIQPFDIDVLGEAFQLKETGSVYLPTSEKGTPTVAGKSRSESKDKERKHKKHKDKDREKDKEHKKHKHRHKDRSKDKEKKKDKSGLHHEKKRKHDGDEDINDVHKHKKSKHKSSKIDEMGAIRVAS |
Length | 207 |
Position | Head |
Organism | Daucus carota subsp. sativus (Carrot) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Apiales> Apiaceae> Apioideae> Scandiceae> Daucinae>
Daucus> Daucus sect. Daucus.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -1.462 |
Instability index | 35.59 |
Isoelectric point | 9.60 |
Molecular weight | 24005.71 |
Publications | PubMed=27158781
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP07270
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 114.42| 21| 21| 124| 144| 1
---------------------------------------------------------------------------
124- 141 (28.35/ 9.51) ....KDKERKHKKHKDKDREKD
142- 157 (24.96/ 7.52) KEHkK......HKHRHKDRSKD
158- 176 (27.47/ 8.99) KEKkKDKSGLH..H.EKKRKHD
178- 198 (33.63/12.60) DED.INDVHKHKKSKHKSSKID
---------------------------------------------------------------------------
|