<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07265
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MSTRGIETDEQQRIRFQVELEFVQCFANPNYLHFLAQRGYFKDPAFVNYIKYLQYWKEPAYAKYLKYPMCLHFLDLLQYEHFRKEIVNGQCARFIDDQQILHWQHYTRKRVKLLQSQAEKHMMTIQNEPTPQKSV |
Length | 135 |
Position | Middle |
Organism | Daphnia magna |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Crustacea> Branchiopoda>
Diplostraca> Cladocera> Anomopoda> Daphniidae> Daphnia.
|
Aromaticity | 0.16 |
Grand average of hydropathy | -0.663 |
Instability index | 35.90 |
Isoelectric point | 8.94 |
Molecular weight | 16527.82 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP07265
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.26| 14| 38| 29| 42| 1
---------------------------------------------------------------------------
29- 42 (27.98/10.87) PNYLHFLA..QRGYFK
68- 83 (23.28/ 8.30) PMCLHFLDllQYEHFR
---------------------------------------------------------------------------
|