<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07263
| Description |
Mediator of RNA polymerase II transcription subunit 15 |
| Sequence | MATDDWKSPGFRQNVAARIEEAIRQSGNPTTKTASEMETHFFQRANNKEDYLNYLARLLIHIKELSAKARAQGGTGVGVAGPQGNVQSNNQQQQVGNISQPQMMNHMNQQHQQMNQQQMNQMVMNQQQQNQQQQMNQQQMNQMGVNQQQQQNQQQMNQFNPNNPNMNIGNPLMQQLGAPNQQQQQQQPQGTAVNNPSSALISQLNQNQQQQNMGPMGGGMPRPRFAGPPGVTATAKMTPQQQQQQQAQAQQQQQMLNQQMLMQQRKQQAEMIQNPSTPQQFAGPGVPSPAQQQQQPMQSMQQQQPMSSGMTSHMSAPSPAYVHSPGNVQLVSSPAAAGRMGGPQQQQQQQRSLSSLLPPPSPSMMNVPTPGGGGMLHTPQGAGMGGMAMTGQGGGMGASGAGTEEQMYLEKVRQLSRFIEPLTRLIGRFGDDDSEKLSKMKIMLDILSNPSKRMPMDTLLKCEAVLEKMDFKRSESGSVAPPSVASVPSLGVAVPTAKDNPPAATPLLSLLETIANQARSPYINHTLQRTFAPAVNSLIGCDIAAPPAPKRRHFDSADDDRADELMDTIEREVANLYPRFKVDMDQMHLMGSQELHLICRLDDKYLPSVPALRIVVPRDYPRMAPFCDSQQPDYDVSSFTRAVLQGLSDRLRHMPHRYTVSQILNCWEMALRHACKPTSNNANNRDVNSLTVALGV |
| Length | 696 |
| Position | Tail |
| Organism | Daphnia magna |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Crustacea> Branchiopoda>
Diplostraca> Cladocera> Anomopoda> Daphniidae> Daphnia.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.753 |
| Instability index | 68.14 |
| Isoelectric point | 8.92 |
| Molecular weight | 76770.94 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP07263
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
6| 269.50| 33| 34| 90| 122| 1
---------------------------------------------------------------------------
90- 118 (52.39/12.24) ......NQQQQ...VGNISQPQMMNHMN.QQHQQ.....MNQQQ
119- 139 (37.16/ 6.69) MNQMvmNQQQQ..................NQQQQ.....MNQQQ
156- 187 (56.23/13.64) MNQF..NPNNP...NMNIGNP.LMQQLG.APNQQ.....QQQQQ
201- 236 (39.09/ 7.39) ISQL..NQNQQ...QQNMG.P.MGGGMP.RPRFAgppgvTATAK
237- 259 (40.11/ 7.77) MTPQ..QQQQQ............QAQ.A.QQQQQ.....MLNQQ
260- 296 (44.51/ 9.37) MLMQ..QRKQQaemIQNPSTPQQFAGPGvPSPAQ.....QQQQP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 64.93| 19| 119| 486| 507| 2
---------------------------------------------------------------------------
486- 507 (27.19/28.70) SVPSLGVAVPtaKDNPPAAtPL
608- 626 (37.74/25.53) SVPALRIVVP..RDYPRMA.PF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 185.24| 42| 42| 301| 342| 3
---------------------------------------------------------------------------
301- 321 (27.06/ 6.97) ........................QQQQPM...SSG..M.TSHMSAPSPAY
322- 364 (66.19/27.45) VHSPGNVQLVSSPAA..AGRMGGpQQQQQQ...QRS..L.SSLLPPPSPSM
367- 408 (49.91/18.93) VPTPGGGGMLHTPQG..AG.MGGmA....MtgqGGG..MgASGAGTEEQMY
409- 451 (42.08/14.83) LEKVRQLSRFIEPLTrlIGRFGD.DDSEKL...SKMkiM.LDILSNPS...
---------------------------------------------------------------------------
|