<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07261
| Description |
Uncharacterized protein |
| Sequence | MTSQIQISEYSLLIYFIKCIAYFLLQHKSLLLQQPQSQQGNNPQLEELKSFKNVLDRFLSFVQISKSNIQMGYKDKLGSYEKQILNSNRPQKPIPPMQLDQSLIPSHVHSMLQSQRQVSNDPSAAY |
| Length | 126 |
| Position | Tail |
| Organism | Daucus carota subsp. sativus (Carrot) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Apiales> Apiaceae> Apioideae> Scandiceae> Daucinae>
Daucus> Daucus sect. Daucus.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.458 |
| Instability index | 52.69 |
| Isoelectric point | 9.27 |
| Molecular weight | 14557.57 |
| Publications | PubMed=27158781
|
Function
| Annotated function |
|
| GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
|
| GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro
transcription coactivator activity GO:0003713 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP07261
No repeats found
No repeats found
|