| Description | Mediator of RNA polymerase II transcription subunit 11 |
| Sequence | MANSSMPIERLQALDNVEKEIASCIQSAGQALTELSKDKASMKQVESHTSQFLKTLNHVEGELSKHINYLTQVSTGQPHEGSAYGSVKMYKTARHRLEHTRSRLQDLENLKNRALASTVRPSSAQNNP |
| Length | 128 |
| Position | Head |
| Organism | Daphnia magna |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Crustacea> Branchiopoda> Diplostraca> Cladocera> Anomopoda> Daphniidae> Daphnia. |
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.752 |
| Instability index | 51.51 |
| Isoelectric point | 9.13 |
| Molecular weight | 14230.82 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP07253
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 58.16| 12| 26| 34| 45| 1
---------------------------------------------------------------------------
16- 27 (18.72/12.83) NVEKEIASCIQS
34- 45 (19.48/13.59) ELSKDKASMKQV
62- 73 (19.96/14.07) ELSKHINYLTQV
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) HEGSAYGSVKMYKTARHRLEHTRSRLQDLENLKNRALASTVR 2) HTSQFLKTLNHVEGELSKHINYLTQVST | 79 48 | 120 75 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab