Description | Mediator of RNA polymerase II transcription subunit 11 |
Sequence | MANSSMPIERLQALDNVEKEIASCIQSAGQALTELSKDKASMKQVESHTSQFLKTLNHVEGELSKHINYLTQVSTGQPHEGSAYGSVKMYKTARHRLEHTRSRLQDLENLKNRALASTVRPSSAQNNP |
Length | 128 |
Position | Head |
Organism | Daphnia magna |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Crustacea> Branchiopoda> Diplostraca> Cladocera> Anomopoda> Daphniidae> Daphnia. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.752 |
Instability index | 51.51 |
Isoelectric point | 9.13 |
Molecular weight | 14230.82 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP07253 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 58.16| 12| 26| 34| 45| 1 --------------------------------------------------------------------------- 16- 27 (18.72/12.83) NVEKEIASCIQS 34- 45 (19.48/13.59) ELSKDKASMKQV 62- 73 (19.96/14.07) ELSKHINYLTQV --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) HEGSAYGSVKMYKTARHRLEHTRSRLQDLENLKNRALASTVR 2) HTSQFLKTLNHVEGELSKHINYLTQVST | 79 48 | 120 75 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab