Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MPAIIPPLDEQEYADPQMPLAHLDSDNNIIFYHMNSPFFEPNSNNSAVYSTAQGHPNGMQLLNDRPTYEAELRKYNSGLQFIVAGEPKAEGQPWLIQRQHKVENRETGNPETVVEGNYYTQGTRLLMAPSLLDVVQARLLTVSTRMQQMAELSKNMSHWSPATGHTYMPPSYDSVKVATAGSRIGSPALAPTDPDASTSQSQTKDATAAIDPTTSTTQFSDDLFMQSLNLSHAYGDEYMDENPLLGEPGAFVFTNSKSHVDARNKAQEQATQASQASQPTIKTDTQPTSVAPSVVATPKGIATPMALDAPSRKSSLAGLPKEERRKRRKSKGLTSPTTPAGSAS |
Length | 344 |
Position | Head |
Organism | Didymella rabiei (Chickpea ascochyta blight fungus) (Mycosphaerella rabiei) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Pleosporomycetidae> Pleosporales> Pleosporineae> Didymellaceae> Ascochyta. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.640 |
Instability index | 51.61 |
Isoelectric point | 5.64 |
Molecular weight | 37351.12 |
Publications | PubMed=27091329 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP07246 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 47.15| 13| 16| 188| 200| 1 --------------------------------------------------------------------------- 188- 200 (23.97/12.66) ALAPTDPDASTSQ 206- 218 (23.18/12.03) ATAAIDPTTSTTQ --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 58.51| 19| 20| 110| 128| 2 --------------------------------------------------------------------------- 110- 128 (34.67/20.20) PE..TVVEGNYYTQGTRL.LMA 129- 150 (23.84/12.23) PSllDVVQARLLTVSTRMqQMA --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 46.86| 13| 16| 19| 31| 3 --------------------------------------------------------------------------- 19- 31 (22.77/12.54) PLAHLDSDNNIIF 37- 49 (24.09/13.62) PFFEPNSNNSAVY --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 33.63| 12| 18| 58| 71| 4 --------------------------------------------------------------------------- 58- 71 (17.26/18.06) GMQ.LLNDRPtyEAE 78- 90 (16.37/ 8.68) GLQfIVAGEP..KAE --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) IFYHM 2) TPMALDAPSRKSSLAGLPKEERRKRRKSKGLTSPTT | 30 303 | 34 338 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab