<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07246
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MPAIIPPLDEQEYADPQMPLAHLDSDNNIIFYHMNSPFFEPNSNNSAVYSTAQGHPNGMQLLNDRPTYEAELRKYNSGLQFIVAGEPKAEGQPWLIQRQHKVENRETGNPETVVEGNYYTQGTRLLMAPSLLDVVQARLLTVSTRMQQMAELSKNMSHWSPATGHTYMPPSYDSVKVATAGSRIGSPALAPTDPDASTSQSQTKDATAAIDPTTSTTQFSDDLFMQSLNLSHAYGDEYMDENPLLGEPGAFVFTNSKSHVDARNKAQEQATQASQASQPTIKTDTQPTSVAPSVVATPKGIATPMALDAPSRKSSLAGLPKEERRKRRKSKGLTSPTTPAGSAS |
| Length | 344 |
| Position | Head |
| Organism | Didymella rabiei (Chickpea ascochyta blight fungus) (Mycosphaerella rabiei) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Pleosporomycetidae> Pleosporales> Pleosporineae> Didymellaceae> Ascochyta.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.640 |
| Instability index | 51.61 |
| Isoelectric point | 5.64 |
| Molecular weight | 37351.12 |
| Publications | PubMed=27091329
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP07246
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.15| 13| 16| 188| 200| 1
---------------------------------------------------------------------------
188- 200 (23.97/12.66) ALAPTDPDASTSQ
206- 218 (23.18/12.03) ATAAIDPTTSTTQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.51| 19| 20| 110| 128| 2
---------------------------------------------------------------------------
110- 128 (34.67/20.20) PE..TVVEGNYYTQGTRL.LMA
129- 150 (23.84/12.23) PSllDVVQARLLTVSTRMqQMA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.86| 13| 16| 19| 31| 3
---------------------------------------------------------------------------
19- 31 (22.77/12.54) PLAHLDSDNNIIF
37- 49 (24.09/13.62) PFFEPNSNNSAVY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 33.63| 12| 18| 58| 71| 4
---------------------------------------------------------------------------
58- 71 (17.26/18.06) GMQ.LLNDRPtyEAE
78- 90 (16.37/ 8.68) GLQfIVAGEP..KAE
---------------------------------------------------------------------------
|