Description | Mediator of RNA polymerase II transcription subunit 11 |
Sequence | MDESAARIQDLHEAEKKLVLLVETAGEALDVLTDDGPSDEDAQLAIRERSGEFTDLTNRYFALVNDVQLAVRRHTHFLTQTASLPSTTKTIPFRHSVAGEQKELEIWTGSLTTLQQRIQQIKRVAQGEQHPQAPASS |
Length | 137 |
Position | Head |
Organism | Absidia glauca (Pin mould) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Fungi incertae sedis> Mucoromycota> Mucoromycotina> Mucoromycetes> Mucorales> Cunninghamellaceae> Absidia. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.522 |
Instability index | 38.30 |
Isoelectric point | 5.15 |
Molecular weight | 15260.81 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP07232 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 74.87| 22| 24| 26| 49| 1 --------------------------------------------------------------------------- 26- 47 (37.21/23.30) GEALDVLTDDGPSDEDAQLAIR 51- 72 (37.66/17.85) GEFTDLTNRYFALVNDVQLAVR --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 68.41| 21| 25| 81| 101| 2 --------------------------------------------------------------------------- 81- 101 (37.10/26.12) TASLPSTTKTIPFRHSVA.GEQ 108- 129 (31.31/21.07) TGSLTTLQQRIQQIKRVAqGEQ --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) GPSDEDAQLAIRERSGEFTDLTNRYFALV 2) TTKTIPFRHSV | 36 87 | 64 97 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab