<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07231
| Description |
Mediator of RNA polymerase II transcription subunit 8 |
| Sequence | MNMTSNPPAIAYLDPHTIQELEALRGKLGSLHETLSTQIAYLKEPKFHFTWPDLLNKFNMLTAKFSSLSEDFHQFTQTGSTATLPKLMLHPWQPPVTEQDTNIISIWLRTKLIPDIEAVEKETLRTIQQEMPEQQQQQSTLQQQQQQQNTQERRVDEDQLIKQQLQQWQALRERHDLLAAEATRLTQELAARYGDVILLRVEDDNDDNNQPAGNEEGPEWKQQGFANEETWKRYKLECMMTFYSMGKDSLVGSDLKSK |
| Length | 258 |
| Position | Head |
| Organism | Absidia glauca (Pin mould) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Fungi incertae sedis> Mucoromycota> Mucoromycotina>
Mucoromycetes> Mucorales> Cunninghamellaceae> Absidia.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.825 |
| Instability index | 53.99 |
| Isoelectric point | 5.00 |
| Molecular weight | 29999.33 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP07231
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.21| 15| 15| 144| 158| 1
---------------------------------------------------------------------------
144- 158 (26.37/13.97) QQQQQNTQERRVDED
162- 176 (27.83/15.12) KQQLQQWQALRERHD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 83.30| 26| 34| 8| 33| 3
---------------------------------------------------------------------------
8- 33 (45.85/35.99) PAIAYLD........PHTIQELEALRGKLGSLHE
37- 70 (37.46/28.07) TQIAYLKepkfhftwPDLLNKFNMLTAKFSSLSE
---------------------------------------------------------------------------
|