| Description | Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MDDILQAQFDRVEQALSTLVDSIASYNPNPQAAIDLVAADDELSHGLDQLARHQANHARIQTLRAEADALEEQLKSSVAALAGLRKELSETPATVFPEDSRPVPFDELLGYAKNISKYTVPPTFRERVPEPELESHKDKDAFEGSASAPATNGVNTPTTAAAAVEAPKGNIEPPKEGAGTDAAAPEITAEEEEWLKKLKDSGFAWFPWPDDAKIRRGNLWKVYHYREHGRNLDEFNIEAYEEEEKKKFLDAVQPQQAPEEMQAEPQFQEQRAQQAPQAQAAPAAPAGAGFTLFDDMESDED |
| Length | 301 |
| Position | Middle |
| Organism | Didymella rabiei (Chickpea ascochyta blight fungus) (Mycosphaerella rabiei) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Pleosporomycetidae> Pleosporales> Pleosporineae> Didymellaceae> Ascochyta. |
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.736 |
| Instability index | 59.59 |
| Isoelectric point | 4.50 |
| Molecular weight | 33191.04 |
| Publications | PubMed=27091329 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP07228
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.77| 15| 16| 250| 265| 1
---------------------------------------------------------------------------
250- 265 (23.10/16.13) DAVQPQQAPEEmQAEP
268- 282 (25.66/13.10) QEQRAQQAPQA.QAAP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 77.28| 24| 24| 6| 29| 2
---------------------------------------------------------------------------
6- 29 (41.10/26.70) QAQFDRV..EQALSTLVDSIASYNPN
31- 56 (36.17/22.77) QAAIDLVaaDDELSHGLDQLARHQAN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.72| 13| 16| 148| 161| 3
---------------------------------------------------------------------------
148- 161 (18.34/16.04) APATNgVNTPTTAA
166- 178 (24.38/15.49) APKGN.IEPPKEGA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.24| 22| 24| 81| 104| 4
---------------------------------------------------------------------------
81- 104 (33.83/30.14) LAGLRKELSEtpATVFPEDSRPVP
108- 129 (40.41/27.92) LLGYAKNISK..YTVPPTFRERVP
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) AGFTLFDDMESDED 2) KKKFLDA 3) QAEPQFQEQRAQQAPQAQAAPA | 288 245 262 | 301 251 283 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab