<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07219
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MSDHNAKRQRLDTSGRYSPASPPFDVAAKASGHTTKPSQPRTPTSPPCASMNSQFNGRFAVTATSASPAKTPPSSATMAQSASQPATSASIQHPFPTPASTTGHSYSTNMDSDGDAVMGDGSEQSARGLGLGIHTHSNHNRQGQALFSDKGGLKAAEGISGSRLFLSSDETYQHSRPHGSQNLFRLYGLERLAKSVARVDPLTGEKINKLRKSYEGHIKTLQIAGKPKAVKMDDVFSGPLGLPDEHWDAVNTGKEPWRKLNTEQTALEPDFSSLLNSAFAGMGPGSLPPSDASKYKAYIGTDDAIRAKPVAEAPPHRGAPFPSSAPTPSSHPLPRRPERSGSKRQYNEDSYQGYSEGYGDDFAADSTGGEDNARGNFKRRKTQFERAAHSVEVGGARR |
| Length | 398 |
| Position | Head |
| Organism | Didymella rabiei (Chickpea ascochyta blight fungus) (Mycosphaerella rabiei) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Pleosporomycetidae> Pleosporales> Pleosporineae> Didymellaceae> Ascochyta.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.851 |
| Instability index | 46.30 |
| Isoelectric point | 9.37 |
| Molecular weight | 42490.22 |
| Publications | PubMed=27091329
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP07219
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 101.12| 21| 23| 43| 63| 1
---------------------------------------------------------------------------
19- 38 (33.56/15.68) PA.SPPF.DVAAKASGHTTKPS
43- 63 (37.44/18.33) PT.SPPCASMNSQFNGRFAVTA
68- 89 (30.12/13.33) PAkTPPSSATMAQSASQPATSA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 236.81| 79| 112| 175| 255| 2
---------------------------------------------------------------------------
175- 217 (53.68/20.39) .....................................................................SRPHGSQNLFRLY.GLERL..AKSVARVDPLTGEKINKLRKSYEGH
218- 331 (102.03/52.01) IKTLQIAGKPKAVKmDDVFSG.PLGLPDEhWDAVNTGKEpwrklnteqtalepdfssllnsafagmgpgSLPPSDASKYKAYiGTDDAirAKPVAEAPPHRGAPFPSSAPTPSSH
334- 391 (81.10/34.63) PRRPERSGSKRQYN.EDSYQGySEGYGDD.FAADSTGGE..............................DNARGNFK.RRKT.QFERA..AHSV.....................
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 83.14| 26| 28| 103| 130| 3
---------------------------------------------------------------------------
104- 130 (43.81/29.87) HSYStNMDSDGDAVMGD.GSEQSARGL.G
134- 161 (39.33/17.85) HTHS.NHNRQGQALFSDkGGLKAAEGIsG
---------------------------------------------------------------------------
|