<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07209
Description |
Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MRDFASIAEHVTKSLQGKNTGPWSLSVKVHRDVNQIMRQAVVKDSRFLYQVALAQQPGQVYCMVDGSVVVEAEKEMEIILSRLKNLWQLRQSVVVEGTSYEIGDFTLRVANILLGSAYKGLLLEIDYHPCSAPNVASDLLREFVENIVPPTAQLSCEYEYDYESVGLSNHEFTTAHTGYQYMMLFRNDGLL |
Length | 191 |
Position | Head |
Organism | Phycomyces blakesleeanus (strain ATCC 8743b / DSM 1359 / FGSC 10004 / NBRC 33097 / NRRL 1555) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Fungi incertae sedis> Mucoromycota> Mucoromycotina>
Mucoromycetes> Mucorales> Phycomycetaceae> Phycomyces.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.105 |
Instability index | 33.96 |
Isoelectric point | 5.20 |
Molecular weight | 21598.38 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP07209
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 33.94| 11| 22| 67| 78| 1
---------------------------------------------------------------------------
67- 78 (14.43/14.83) SVVVEAEKeMEI
92- 102 (19.52/13.88) SVVVEGTS.YEI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 92.15| 26| 33| 109| 134| 2
---------------------------------------------------------------------------
109- 134 (45.83/31.03) VANILLGSAYKGLLLEIDYHPCSAPN
144- 169 (46.32/31.42) VENIVPPTAQLSCEYEYDYESVGLSN
---------------------------------------------------------------------------
|