Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MASSLRDQVNALLTDYSGLIKNYFHAISLVAENTPVDEQHSPETLLKKIVGVDRALQQAIESKEEKQSTYILYIQNEQTKRIDRFLLLVDEHQARQRRIIQVQDDIQRHQMTMLEIVQRLHDARENIDLDLTQAKRELKAIEYSKDSNVQFTEILSYASKLSKYTSAPPNFELISRDMKIEFEKPYPDEERMRRGQLYWQHAPQPVPEDQFESSDSDSAMEEEINKEAGSTGQPEESQGDPFWILDLNPDMPS |
Length | 253 |
Position | Middle |
Organism | Phycomyces blakesleeanus (strain ATCC 8743b / DSM 1359 / FGSC 10004 / NBRC 33097 / NRRL 1555) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Fungi incertae sedis> Mucoromycota> Mucoromycotina> Mucoromycetes> Mucorales> Phycomycetaceae> Phycomyces. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.794 |
Instability index | 59.25 |
Isoelectric point | 4.79 |
Molecular weight | 29413.50 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP07206 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 49.87| 14| 16| 92| 105| 1 --------------------------------------------------------------------------- 92- 105 (24.54/14.73) HQARQRRIIQVQDD 109- 122 (25.33/15.40) HQMTMLEIVQRLHD --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 49.88| 14| 16| 163| 176| 2 --------------------------------------------------------------------------- 163- 176 (24.13/11.89) KYTSAPPNFELISR 181- 194 (25.75/13.05) EFEKPYPDEERMRR --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DSAMEEEINKEAGSTGQPEESQGDPFWILDLNPDMPS 2) VPEDQFESSD | 217 206 | 253 215 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab