| Description | Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MDKVIDARFERVEKALASLIESVSKYHPHAKQALDLHEADNDLAKGLDEVQIHQNNHLRLQQLRATTSSLDTQIRETLQSLATTRKDITTTQITIYPDGPKYPVKYDELLNYARRISKTTLPPAALTNGGGVTTGGGTPAPDPNASMTTNPNTPGANGPQSQPVSAAPTPSQSQTPGPSGAPNSSPLQDALQGTQQTTTTSGATSLPDGLRNHLDPHFNASFIPWPNEFQIRSGAMAVYEDLADKGIDPRGYDPQQIAEAKRKEEEERKAREEQEKLEIERKNREYQEKMEKIRREQQEAYRRDSVAAGAGASSAGKSKQFQFTSLMDDDDDDE |
| Length | 334 |
| Position | Middle |
| Organism | Colletotrichum incanum |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Glomerellales> Glomerellaceae> Colletotrichum> Colletotrichum spaethianum species complex. |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.958 |
| Instability index | 51.07 |
| Isoelectric point | 5.25 |
| Molecular weight | 36720.93 |
| Publications | PubMed=27189990 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP07193
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 97.31| 20| 20| 153| 172| 1
---------------------------------------------------------------------------
133- 145 (24.96/ 9.16) TTGGGT.P.......APDPNA
153- 172 (39.08/17.82) TPGANG.PQSQPVSAAPTPSQ
175- 195 (33.28/14.27) TPGPSGaPNSSPLQDALQGTQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.49| 17| 31| 201| 217| 2
---------------------------------------------------------------------------
201- 217 (31.83/24.00) SGATSLPDGLRNH.LDPH
233- 250 (25.66/17.86) SGAMAVYEDLADKgIDPR
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) AGKSKQFQFTSLMDDDDDDE 2) EAYRRDSVAA | 315 299 | 334 308 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab