<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07192
Description |
Cyclin |
Sequence | MAANYWASSQQNHWLLDRWNLAKSSEEDRKYLSEKDYVKIKIWFNHLIQKLAKRLQLRQQVVATAFVYFKRFYTKNSLRSTDPTLVLVTCVYLATKIEECPIHIKMVTQEAKHIFQADFGGFPYDSAKVAEFEFYLLEELEFYLIVWHPYRSLTLICNDLGMRESGLQYAWFLVNDSYRTDVCLLYPPHMIALAAIYLTVVLNHADFAPGSLGDRTDMRQWFADLNVDIEAVIEISQEILSITEVWSDWKEEKMPMLWKELKLPRQ |
Length | 266 |
Position | Kinase |
Organism | Phycomyces blakesleeanus (strain ATCC 8743b / DSM 1359 / FGSC 10004 / NBRC 33097 / NRRL 1555) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Fungi incertae sedis> Mucoromycota> Mucoromycotina>
Mucoromycetes> Mucorales> Phycomycetaceae> Phycomyces.
|
Aromaticity | 0.14 |
Grand average of hydropathy | -0.146 |
Instability index | 57.22 |
Isoelectric point | 5.84 |
Molecular weight | 31439.93 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP07192
No repeats found
|