Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MSFHPQTPQSPSHLSPITSDPLSGASSVSFATTTNTVNTAGQGGGGSFSSSAAPTASTLPTPAQSVNGSGLGLMDMGAGEDSPHKRKRELDDAGDHESKKMYMEGQQRLDFEALHQDVGEKYLVCKTPHRPSFPPLSADLFSMFNLTGIAADVARTLPNGEKNAMRKTYKGYMKKLGVSGHFEPVKRDEGDESDFMRLITEAEDSWQARQVKTKEIRYGLQGDVEADLRQAMTMNKGPIPKAVWDSSVLGDLAPEKLLFIGAKPGSVRGTAPNTPLHPAVMARSSKAQPSPSFGTTGAAAAGGGPDLARPRRANKKRSYGDNSFEGYGEGFPDDDGGYSTGEGDGPNHKRRKKNSTPTTQYPVAPVRQQSYGPGMVGA |
Length | 378 |
Position | Head |
Organism | Sporothrix insectorum RCEF 264 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Sordariomycetidae> Ophiostomatales> Ophiostomataceae> Sporothrix. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.723 |
Instability index | 49.84 |
Isoelectric point | 8.41 |
Molecular weight | 40219.31 |
Publications | PubMed=27071652 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP07187 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 316.56| 71| 152| 127| 197| 1 --------------------------------------------------------------------------- 7- 102 (85.04/39.36) TPQSPShLSPIT..SDPLS..gassvsfatttntvntagqggggSFSSSAA.....PTASTLPTPAQ.SV.NGSGLGLM.DMG.AGEDSPHKRkreldDAGDhESKKMY 127- 197 (127.72/62.46) TPHRPS.FPPLS..ADLFSMF.......................NLTGIAA.....DVARTLPNGEKNAM.RKTYKGYMKKLGVSGHFEPVKR.....DEGD.ESDFMR 274- 350 (103.80/49.51) TPLHPA.VMARSskAQPSPSF.......................GTTGAAAagggpDLARPRRANKKRSYgDNSFEGYGE..GFPDDDGGYST.....GEGD.GPNHKR --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) NHKRRKKN 2) TPTTQYPVAPVR | 347 356 | 354 367 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab