<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07185
| Description |
Mediator of RNA polymerase II transcription subunit 8 |
| Sequence | MALGLDDDELKSVEQILSRLAQLSSSIQSLKMDILKSNPLPHPDSLHASARILQRNLSTVLDCLSENAELFSRVAVRPSTNYPGRAQENVLTQLLRKKLEPDVEELVEEGREAARRVTPEGVAELQAIWDELRAWTQSRIAEYVRDEAGDVYTKEERAMGVEKVRTGLRREIEEDDEEEDDDEDEDEDGRDGATAAAAAAAGVNEVAALPPRGPEIETLLWFMTRADFDVPRNIEYERKGAVLMRGLEGINIPPDSTDSVQPGASATQPMQL |
| Length | 272 |
| Position | Head |
| Organism | Beauveria brongniartii RCEF 3172 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Cordycipitaceae> Beauveria>
Beauveria brongniartii.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.578 |
| Instability index | 55.07 |
| Isoelectric point | 4.44 |
| Molecular weight | 30190.21 |
| Publications | PubMed=27071652
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP07185
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.88| 20| 72| 85| 105| 1
---------------------------------------------------------------------------
85- 105 (30.38/20.51) RAQ..ENVLTQlLRKKLEPDVEE
157- 178 (30.51/16.30) RAMgvEKVRTG.LRREIEEDDEE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 64.30| 21| 78| 108| 128| 2
---------------------------------------------------------------------------
108- 128 (35.10/20.80) EEGREAAR..RVTPEGVAELQAI
187- 209 (29.20/16.21) EDGRDGATaaAAAAAGVNEVAAL
---------------------------------------------------------------------------
|