<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07180
| Description |
Mediator of RNA polymerase II transcription subunit 8 |
| Sequence | MAALGLDDDELKSVEQILSRLAQLSNSIGSLKMDVMKSHPLPHPDSLHASAQILHRNLATVLECLSENAELFTRIAIHPSTNFPGRAQEGVLTQLLRKKLEPDVEELVEQGRETARRATPEGLAALQAIWDELRAWTQTRIADYVRDEAGDAYTKEERAQGTETVRTGLRRDIEDEDEDEDEDEEDEDEDEDGGGMFGTATAAAAPAGSNDAPLPPAQGPEIETLLWFGARGDFELPRNVEYERKGAVLKRGLEGINIPPERMDGVLQAGGSAAQPMRL |
| Length | 279 |
| Position | Head |
| Organism | Cordyceps confragosa RCEF 1005 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Cordycipitaceae> Akanthomyces>
Cordyceps confragosa.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.610 |
| Instability index | 50.19 |
| Isoelectric point | 4.47 |
| Molecular weight | 30601.54 |
| Publications | PubMed=27071652
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP07180
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 80.61| 25| 172| 40| 92| 1
---------------------------------------------------------------------------
52- 76 (40.69/56.32) QILHRNLATVLECLSENAELFTRIA
94- 118 (39.92/ 7.49) QLLRKKLEPDVEELVEQGRETARRA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.90| 14| 15| 239| 252| 3
---------------------------------------------------------------------------
239- 252 (24.43/14.16) NVEYERKGAVLKRG
257- 270 (26.48/15.86) NIPPERMDGVLQAG
---------------------------------------------------------------------------
|