<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07159
| Description |
Uncharacterized protein |
| Sequence | MASTPLLPPNAAAGNPNFDGNARATPAPPGTDMTGICFRDQLWLNTYPLDRNLVFDYFALSPFYDWTCNNETIRMRSIHPLDHSHLSKMTGIEYALSEVTEPHLFVIRKQKRDSPDKVTPMLTYYVLDGSIYQAPQLCNVFASRVGRALYHISKAFTTAASKLEKIGYVDTENESATLLAKAPKETIDLKEVKRIDHILASLQRKLPPAPPPPPFPEGYNPPKSAEGENASEAQAQLPPVDPILDQGPSKRMKF |
| Length | 254 |
| Position | Head |
| Organism | Daucus carota subsp. sativus (Carrot) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Apiales> Apiaceae> Apioideae> Scandiceae> Daucinae>
Daucus> Daucus sect. Daucus.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.441 |
| Instability index | 51.13 |
| Isoelectric point | 6.60 |
| Molecular weight | 28234.87 |
| Publications | PubMed=27158781
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP07159
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.66| 10| 196| 7| 18| 1
---------------------------------------------------------------------------
7- 18 (16.90/10.09) LPPnaAAGNPNF
206- 215 (23.76/ 9.56) LPP..APPPPPF
---------------------------------------------------------------------------
|