Description | Uncharacterized protein |
Sequence | MASTPLLPPNAAAGNPNFDGNARATPAPPGTDMTGICFRDQLWLNTYPLDRNLVFDYFALSPFYDWTCNNETIRMRSIHPLDHSHLSKMTGIEYALSEVTEPHLFVIRKQKRDSPDKVTPMLTYYVLDGSIYQAPQLCNVFASRVGRALYHISKAFTTAASKLEKIGYVDTENESATLLAKAPKETIDLKEVKRIDHILASLQRKLPPAPPPPPFPEGYNPPKSAEGENASEAQAQLPPVDPILDQGPSKRMKF |
Length | 254 |
Position | Head |
Organism | Daucus carota subsp. sativus (Carrot) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> campanulids> Apiales> Apiaceae> Apioideae> Scandiceae> Daucinae> Daucus> Daucus sect. Daucus. |
Aromaticity | 0.09 |
Grand average of hydropathy | -0.441 |
Instability index | 51.13 |
Isoelectric point | 6.60 |
Molecular weight | 28234.87 |
Publications | PubMed=27158781 |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP07159 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 40.66| 10| 196| 7| 18| 1 --------------------------------------------------------------------------- 7- 18 (16.90/10.09) LPPnaAAGNPNF 206- 215 (23.76/ 9.56) LPP..APPPPPF --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EVKRIDHILASLQRKL 2) ILDQGPSKRMKF | 191 243 | 206 254 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab