<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07140
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MDKVIDARFERVEKALASLIESVSKYHPHAKQALDLHEADNDLAKGLDEVQTHQNNHLHLQQLRATTSSLDTQIRETLQSLATTRKDITTTQITVYPDGPKYPVKYDELLNYARRISKTTLPPAALTNGGGVTTGGDTPAPDPNASMTTNPNTPGANGPQSQPVSAAPTPSQSQTPGPSGAPNSSPLQDALQGTQQTTTTSGATSLPDGLRNHLDPHFNASFIPWPNEFQIRSGAMAVYQDLADKGIDPRGYDPQQIAEVKRKEEEERKAREEQEKLEIERKNREYQEKMEKIRREQQEAYRRDSVAAGAGASSAGKSKQFQFTSLMDDDDDDE |
| Length | 334 |
| Position | Middle |
| Organism | Colletotrichum tofieldiae |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Glomerellales> Glomerellaceae> Colletotrichum>
Colletotrichum spaethianum species complex.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.973 |
| Instability index | 49.47 |
| Isoelectric point | 5.23 |
| Molecular weight | 36760.91 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP07140
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 102.11| 20| 20| 153| 172| 1
---------------------------------------------------------------------------
133- 150 (31.94/16.11) TTGGDT.PAPDP..NASMTTN
153- 172 (37.07/19.87) TPGANG.PQSQPVSAAPTPSQ
175- 195 (33.10/16.96) TPGPSGaPNSSPLQDALQGTQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.67| 17| 30| 201| 217| 2
---------------------------------------------------------------------------
201- 217 (31.80/17.60) SGATSLPDGLRNH.LDPH
233- 250 (25.87/13.20) SGAMAVYQDLADKgIDPR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.00| 11| 29| 262| 272| 3
---------------------------------------------------------------------------
262- 272 (17.19/11.23) RKEEEERKARE
294- 304 (17.80/11.87) RREQQEAYRRD
---------------------------------------------------------------------------
|