<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07125
| Description |
Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MSSIFPECDQLKQSNLPHPQIISDSGESRFNHLERTLEQFQSLFLKELDQMRSQFMDVKVPLELLDVLDQGKNPQLYTKEVLERTLMKNKEVNGKVETYKKFRAALLTMSIGANPIFRPHNAASAALIKFVPNFVALRLSWTQNSLRSEGMEQFVEEFLPTIRENNPQVKYFLHRTYTECDPFVVGEYTWMRHRKKRVSWRSKHQVLSMVEEMAVGGDYRPGLKRGVNRRLPRGQELWDTETIGHDIFKVMSKWKADEDDLDMPTSEKHPHFVYRKY |
| Length | 277 |
| Position | Middle |
| Organism | Nippostrongylus brasiliensis (Rat hookworm) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Strongylida>
Trichostrongyloidea> Heligmonellidae> Nippostrongylinae> Nippostrongylus.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.648 |
| Instability index | 46.48 |
| Isoelectric point | 8.90 |
| Molecular weight | 32596.00 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP07125
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 142.39| 45| 51| 159| 209| 1
---------------------------------------------------------------------------
159- 209 (74.73/57.48) LPTIRENNPQVKYFLHRTYTEcdpfvvGEYTW....MRHRKKRV..SWRSKHQVLSM
213- 263 (67.66/39.41) MAVGGDYRPGLKRGVNRRLPR......GQELWdtetIGHDIFKVmsKWKADEDDLDM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 81.29| 19| 19| 45| 63| 2
---------------------------------------------------------------------------
24- 38 (18.73/ 8.37) ....DSGESRFNHLERTLE
45- 63 (31.95/18.49) LKELDQMRSQFMDVKVPLE
65- 83 (30.62/17.47) LDVLDQGKNPQLYTKEVLE
---------------------------------------------------------------------------
|