<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07105
Description |
Uncharacterized protein |
Sequence | MADRITQLQDLVNELANHMCNSIGALQALAPSCDFNSSSKQLESEPNCALFAANIAHTAKDIEVLIDSLPVEDPVTGGVECDEELLKMDEQRRRVTEGEELIELIQKKLSEIAHIQMESRPSM |
Length | 123 |
Position | Middle |
Organism | Enterobius vermicularis (Human pinworm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Spirurina> Oxyuridomorpha> Oxyuroidea> Oxyuridae> Enterobius.
|
Aromaticity | 0.02 |
Grand average of hydropathy | -0.278 |
Instability index | 83.43 |
Isoelectric point | 4.43 |
Molecular weight | 13621.29 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036
|
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP07105
No repeats found
No repeats found
|