<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07099

Description Uncharacterized protein
SequenceMKNRKADGTPRTDAHTHTVYRSRSRFFVIWRIRRIYSLVCLLMIDYHFKEELIKTRERVEDLFSFEGSKVGRGTYGHVYKAQPRHPEQLPKNGAKEFALKLIEGQGFSMSACREIALLRELRHPNLIKLQRVFLTNERKVWLLLDYAEHDLWHIIKFHRAAKQKKQPVLVPKGMVKSLLYQILDGIHYLHSNWILHRDLKPANILVMGEGPGVERGRVKIADMGFARIFHSPLKPLAELDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPVFFCREEDIKASSPYHQDQLNRIFTVMGYPSESDWQDLKKMPEYQKLTQDFKRSNYANCTLQRYMDKHKIKADTRSFSLLQRLLTMDPIKRVTAQDAMDDPYFKEDPRPTADVFSGCDIPYPKREFLSDENDDKSSSASKTQAAPPPQQSQQAIPVHPQQQIMEPAAKKMRLQTNQMPPTQSQMEPMMNATGPLYGTSNAQEYPTVGSGPAVVNKGPMNFEQSQIVQPQHMNSTIPQIQYGQHQIINQTPTMYQQQPQMSMPQQQMTNSAQGQIQGRPMQIPAQSSMMPPSYQQQLMQPGIMGNQQMMAGPANTVMPQQNGMGGSGPLGGPQGQMTHQGPMMQQMRPQVQFVDQNGRVIPQSAGIMVGQSTQEIISQQGQYMMQQQQWPPMQPRYQ
Length677
PositionKinase
OrganismDracunculus medinensis (Guinea worm)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Spirurina> Dracunculoidea> Dracunculidae> Dracunculus.
Aromaticity0.08
Grand average of hydropathy-0.619
Instability index52.12
Isoelectric point9.33
Molecular weight77523.31
Publications









Function






Annotated function


GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-UniRule
protein kinase activity	GO:0004672	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP07099
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             5|     121.20|      18|      18|     501|     518|       1
---------------------------------------------------------------------------
  462-  476 (22.97/ 7.74)	.QSQM..EPM.MNATGPL..Y
  502-  521 (29.47/12.24)	EQSQIV.QPQHMNSTIPQiqY
  612-  632 (22.34/ 7.30)	PQGQMThQGPMMQQMRPQvqF
  649-  662 (20.97/ 6.35)	GQS.....TQEIISQQGQ..Y
  665-  676 (25.46/ 9.46)	QQQQW..PPMQ.....PR..Y
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     134.30|      35|      36|     322|     356|       2
---------------------------------------------------------------------------
  288-  320 (26.49/13.03)	.........ED.IKASSpYHQDQLNRiftvmgYPSESDWQ.DLK
  322-  356 (64.60/42.06)	MPEYQK.LTQD.FKRSN.YANCTLQR......YMDKHKIKADTR
  358-  389 (43.21/25.77)	FSLLQRlLTMDpIKR......VTAQD......AMDDPYFKEDPR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      72.34|      18|      42|     538|     557|       4
---------------------------------------------------------------------------
  436-  448 (23.23/ 6.55)	P..VHPQQQ..IMEPA.....A
  538-  557 (26.30/15.59)	PqMSMPQQQ..MTNSAQGQIqG
  559-  577 (22.81/ 6.07)	P.MQIPAQSsmMPPSYQQQL..
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     127.82|      35|      41|     152|     191|       6
---------------------------------------------------------------------------
  152-  187 (60.71/52.65)	WHIIkFHRAAK..QKKQPVL.....VPKGMVKSLLYQ....ILD.GIH
  193-  225 (33.71/29.03)	W.IL..HRDLK..PANILVMgegpgVERGRVK.........IADmGF.
  227-  259 (33.40/22.92)	.RI..FHSPLKplAELDPVV.....V......TFWYRapelLLG.ARH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      44.77|      12|      23|     579|     591|       9
---------------------------------------------------------------------------
  579-  591 (20.55/14.61)	QPGiMGNQQMMAG
  600-  611 (24.22/12.63)	QNG.MGGSGPLGG
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP07099 with CDK8 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) PKREFLSDENDDKSSSASKTQAAPPPQQSQQAIPVHPQQQIMEPAAKKMRLQTNQMPPTQSQMEPMMNATGPLYGTSNAQEYPTVGSGPAVVNKGPMNFEQSQIVQPQHMNSTIPQIQYGQHQIINQTPTMYQQQPQMSMPQQQMTNSAQGQIQGRPMQIPAQSSMMPPSYQQQLMQPGIMGNQQMMAGPANTVMPQQNGMGGSGPLGGPQGQMTHQGPMMQQMRPQVQFVDQNGRVIPQSAGIMVGQST
403
652










Molecular Recognition Features






MoRF SequenceStartStop




NANANA