<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07094
| Description |
Mediator of RNA polymerase II transcription subunit 18 |
| Sequence | MSHQIIFVPLITSTSPSSSTYQCKECILYGSVLKEHEEKLLQRLRGLCDPGQHSFNEHEMVFSLKTGQDPDVTVRLRRKFGGPDANSFQWHFRYMGAAEPDVHCPTIIRKSIDSLIYSSNMMEFVKTLGLRMDYEYLTKGYLFTKGYIKIIINNITRTEKIGTYDPNVLKPLSDSLLIEMSAALPDTKEYMTTAKALRSFADQLSPICDMQKVEYWRRLQ |
| Length | 220 |
| Position | Head |
| Organism | Brugia malayi (Filarial nematode worm) |
| Kingdom | Metazoa |
| Lineage | |
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.331 |
| Instability index | 45.81 |
| Isoelectric point | 8.20 |
| Molecular weight | 25350.99 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP07094
No repeats found
|