<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07085

Description Uncharacterized protein
SequenceMASHPVGVSPFPQPPEYARQYTDANVAKKNVLPPPPVPSEFTVFGEEYNFEEEMIRSLQSQKMQQLFSSNGDWRSELKKLNRSTVAAFLDLLDILIRCPNHPERLEKINNLRLLFINMHHLINEYRPVQARDALQSMMRLLIKTIEDVTSRFRTYLAMGHEALNQVIDEVPPVLSASPMLNVEDVNVGVSIEQQVGAVETEISKRRSSYDEARKTTVSRREAWRRDVMLCELLDNMGDADLERRLSPSTNKHCMFLSQSLSCIRVCERCKNELIDMPESGKQCESIHIQTRNSRHPLLCTECHKRFQTVQELYLHSEICIIESFENEAVNVFSNMPSLTKSTAVFDATTHAGITAKGDDPPILIPETNASTSSSRLTTLSFSAKCKVECSRFKKTQVTVPTGTTKTAPLSLVSTSHLEQRYWSSSERLQKIPFELENARILESPSGLKIYISIERKCGREGNGVISGNDGYYYGSQGVLGSNATNSKRKIIGALANANNDDIYRTKMECPACGLILYRHNFGTHYRIHTGELPFICTYCQKRFRTTSALKVHIRQESLEEAHTGEKPYSCPKCSYCCITKRNLDRHITNNHVREGERRGPRERRSRYRKDEFSVTIDDIEMGTVEESEKIDHHYVISPVEIEKNVVEEKTNDEMQGRDDNRQSVDMPVLPLLTL
Length674
PositionMiddle
OrganismBrugia pahangi (Filarial nematode worm)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Spirurina> Spiruromorpha> Filarioidea> Onchocercidae> Brugia.
Aromaticity0.06
Grand average of hydropathy-0.545
Instability index64.69
Isoelectric point6.88
Molecular weight76804.40
Publications









Function






Annotated function


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP07085
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     149.31|      33|      33|     528|     560|       1
---------------------------------------------------------------------------
  296-  315 (25.07/ 8.73)	.....PLLCTECHKRFQTVQELYLH........
  528-  560 (60.79/29.37)	HTGELPFICTYCQKRFRTTSALKVHIRQESLEE
  562-  594 (63.45/30.90)	HTGEKPYSCPKCSYCCITKRNLDRHITNNHVRE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      85.63|      25|     382|     213|     237|       2
---------------------------------------------------------------------------
  213-  237 (45.13/27.89)	RKTTVSRREAWRRDVMLCELLD.NMG
  597-  622 (40.50/24.36)	RRGPRERRSRYRKDEFSVTIDDiEMG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.77|      16|      26|     111|     126|       3
---------------------------------------------------------------------------
  111-  126 (27.99/20.98)	LRLLFINMHHLINEYR
  138-  153 (25.78/18.73)	MRLLIKTIEDVTSRFR
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP07085 with Med7 domain of Kingdom Metazoa
Unable to open file!