<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07074
| Description |
Uncharacterized protein |
| Sequence | MLTCEDEVLAIGRKLDKIVDGSKSGESAADLLDVLSKLPITIDVLTKTRIGMTINDLRKKTSDEKLAKKAKNLIKEWKNLVDKREEKKEKTPKCEPTSNSSAKNNKPSSNQQLSKPASSVSNQAYSSSFPPKHLENDEVRLKSVQMILTALRHADLPDGTLDPEEIAIKVEERIFSVHKGTGDKYKAALRSRVFNLRDKKNPALRENVLTGVVKPEKFAVMTSEEMASDEVREMREKFNKAAILEHQMSVQQGTPSDMFKCGKCGKKNCTYTQLQTRSSDEPMTTFVFCLECGNRWKFC |
| Length | 299 |
| Position | Unknown |
| Organism | Angiostrongylus costaricensis (Nematode worm) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Strongylida>
Metastrongyloidea> Angiostrongylidae> Angiostrongylus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.687 |
| Instability index | 37.91 |
| Isoelectric point | 9.10 |
| Molecular weight | 33632.29 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | nucleic acid binding GO:0003676 IEA:InterPro
zinc ion binding GO:0008270 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
transcription, DNA-templated GO:0006351 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP07074
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.62| 13| 25| 255| 267| 1
---------------------------------------------------------------------------
255- 267 (27.15/19.73) PSDMFK.CGKCGKK
282- 295 (22.47/15.10) PMTTFVfCLECGNR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 80.84| 17| 18| 159| 175| 2
---------------------------------------------------------------------------
134- 148 (14.22/ 7.15) ..LENDEVRLKSVQMIL
159- 175 (28.14/21.08) GTLDPEEIAIKVEERIF
180- 194 (23.22/16.16) GTGDKYKAALR..SRVF
211- 224 (15.26/ 8.19) GVVKPEKFAVMTSE...
---------------------------------------------------------------------------
|