<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07071
| Description |
Mediator of RNA polymerase II transcription subunit 15 |
| Sequence | MLDHIKFFNKTRKKSGKYERRAGKHGKSITFLTPDDSAVFYDLKQCLMESPISTCPAELSNHPDAQQKPGTFTTKKRQDETLFKEPELARNRQNAPNLPVPGDARQVEEYVFQKCLSKDEYMRTIAKVINAINCNSKSAAVPSVLQPSFHSPPCSAPSVNGTNTNSTSYRASVPPDPQPTQARAQNQATSSAVPQQQIPLQQPQACVVVGHQQSTFPSSDQQRAPPSYASPPLGQPPPQMQPTGAQSVPQQQEPLPRSWDGQGMHYLTPQQQWSQHPLYNQTQQQQQIPSHQGQHHGQQPPSSGQSTVLEALINQPQYPSAPHQASFLIFVKNPEKLQISRHPHMMMSGPGAPMGPGGHIGGSLDSQPDQQQVYNQKLRMLKPYCENLKLRAQQCRMEGNTEAAQKLETMLGVLEGRRVVSLEYLLNLENWIHKKADFLAATTHPHPSVVQNGHMGMAGQGMVDGINAVLNASSEHHLNSVYGTHGAYVPQTLHQGTYPHMHPQQMWPPQHMQQQGMMVGPPINQSGGGGPMQTYRESPVEHHRPYPSMRPQLRPPPVVQSMQSQPSVDSPRMGASNIAIVGRNTIPLSSGPATSTSTTHVVSSVGGNSSTGSSGSAEQPGIDDLYNMDDFLPTPLEAVGGMQGSGNRPSLPEAARREFSQLSDRFEFDSSAESHHDPHSALVNCKMRGQQVPALRLVIPLSYPAACVTVDRAAIDLDAFFYDDLQNVVHERLARPGLHSITEFLNTWVISGLFRNTVQTTESIMRTDPTLIWYSHPTVLWIPSDIAPLLVSP |
| Length | 793 |
| Position | Tail |
| Organism | Angiostrongylus cantonensis (Rat lungworm) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Strongylida>
Metastrongyloidea> Angiostrongylidae> Angiostrongylus.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.627 |
| Instability index | 56.42 |
| Isoelectric point | 7.23 |
| Molecular weight | 87209.07 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP07071
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 120.56| 29| 29| 130| 158| 1
---------------------------------------------------------------------------
130- 157 (45.60/16.84) ...............NAINCNSKS..AAVPSVLQ....PSFHSPPCSAP
158- 189 (40.18/13.96) S.............vNGTNTNSTSyrASVPPDPQ....PTQARAQNQAT
190- 236 (34.78/11.08) SsavpqqqiplqqpqACVVVGHQQ..STFPSSDQqrapPSYASPPLGQP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.96| 18| 18| 300| 317| 2
---------------------------------------------------------------------------
344- 361 (29.08/11.40) HMMMSGPGAPMGPGGHIG
516- 533 (25.87/ 9.11) GMMVGPPINQSGGGGPMQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 125.58| 22| 47| 494| 515| 3
---------------------------------------------------------------------------
275- 294 (35.97/10.95) QHPLYNQTQQQQQIP....SHQGQ
494- 515 (49.21/17.48) HQGTYPHMHPQQMWPP..QHMQQQ
542- 565 (40.40/13.13) HHRPYPSMRPQLRPPPvvQSMQSQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 159.84| 45| 153| 442| 486| 4
---------------------------------------------------------------------------
442- 486 (83.94/54.72) TTHPHPSVVQNGHMGMAGQGMVDGINAVLNASS..EHHLNSVYGTHG
598- 644 (75.90/48.69) TTHVVSSVGGNSSTGSSGSAEQPGIDDLYNMDDflPTPLEAVGGMQG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.34| 10| 52| 193| 202| 5
---------------------------------------------------------------------------
193- 202 (20.87/10.14) VPQQQIPLQQ
248- 257 (21.47/10.67) VPQQQEPLPR
---------------------------------------------------------------------------
|