<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07070
| Description |
Uncharacterized protein |
| Sequence | MILANKIRRINTQTNIQLTVKPLSLARINTFSVSLYFLHPLNLLPLFLIFHFFSLYVTWASSSSTNPIALFLAQEFLSLKKQNLQFYFTVDNLSGENIKPANWAVTDAYLNYMKRPVEDLAWNPELDYYFKLISRVVDTFQGKSPFPHVDWRFNEFANAGVHALHITCIELMALPVAANVVANNLIDLVVVGHKYIPRNTIEFWNNAIGVVLTALPEAYWSVINDRIISMMESPLLTYSPHFEPFQMINFMLSEHVKLWKLLSSCTLSSRLLIKIALSYVLWTLVYIDLTH |
| Length | 291 |
| Position | Tail |
| Organism | Tetranychus urticae (Two-spotted spider mite) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Acari>
Acariformes> Trombidiformes> Prostigmata> Eleutherengona> Raphignathae>
Tetranychoidea> Tetranychidae> Tetranychus.
|
| Aromaticity | 0.13 |
| Grand average of hydropathy | 0.321 |
| Instability index | 39.55 |
| Isoelectric point | 7.81 |
| Molecular weight | 33547.80 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP07070
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 38.67| 14| 17| 21| 36| 1
---------------------------------------------------------------------------
21- 36 (20.04/17.84) KPLSLarINTFSV....SLY
39- 56 (18.63/ 9.41) HPLNL..LPLFLIfhffSLY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.41| 12| 17| 107| 118| 2
---------------------------------------------------------------------------
107- 118 (22.23/12.17) DAYLNYMKRPVE
127- 138 (21.18/11.33) DYYFKLISRVVD
---------------------------------------------------------------------------
|