<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07064
Description |
Uncharacterized protein |
Sequence | MATPTNSDCNLVDEFEESFQQCLSILTKDEGLGNSGTGASGGLTVDKDEGRAEIEQATMRFIDLARQMEAFFLQKRFLLSALKPEMLVKEEINELKLELARKEELIKRHNDKIAVWQNMLSDLQGWAQSPAQGPAPSGLPNGNQSGQNQQASGGSGNASMQQQQQILQHQQQLQQQLQQQQQQQQHPQLQQQLQQQMQHPLQSQVQQGSGGPPTSGLQGVGVPVNQQGMFMAQGGVGGRATGFPVGGMGSSALQGPLAYLEKTTSNIGMPERRS |
Length | 274 |
Position | Head |
Organism | Atta cephalotes (Leafcutter ant) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Hymenoptera> Apocrita> Aculeata> Formicoidea>
Formicidae> Myrmicinae> Atta.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.704 |
Instability index | 69.75 |
Isoelectric point | 5.28 |
Molecular weight | 29789.95 |
Publications | PubMed=21347285
|
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP07064
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.09| 18| 18| 161| 178| 1
---------------------------------------------------------------------------
161- 178 (36.50/14.19) QQQQQILQHQQQLQQQLQ
181- 198 (37.58/14.81) QQQQQHPQLQQQLQQQMQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 34.76| 10| 55| 144| 154| 3
---------------------------------------------------------------------------
144- 154 (15.15/ 9.46) QSgQNQQASGG
202- 211 (19.61/ 7.55) QS.QVQQGSGG
---------------------------------------------------------------------------
|