<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP07044
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MNRLDDPPGLMKGRKPSFIGMNGAPETDDQQRVRFQVELEFVQCLANPNYLNFLAQRGYFKDMTFINYLKYLLYWKEPEYAKYLKYPMCLYFLDLLQYEHFRREVVNSQCTKFIDDQQILLWQHYTRRRTRLLQTAAEQTQHTNSQNNGIVQPKVP |
| Length | 156 |
| Position | Middle |
| Organism | Atta cephalotes (Leafcutter ant) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Hymenoptera> Apocrita> Aculeata> Formicoidea>
Formicidae> Myrmicinae> Atta.
|
| Aromaticity | 0.14 |
| Grand average of hydropathy | -0.675 |
| Instability index | 37.38 |
| Isoelectric point | 8.94 |
| Molecular weight | 18784.32 |
| Publications | PubMed=21347285
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP07044
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 87.82| 22| 44| 39| 61| 1
---------------------------------------------------------------------------
39- 61 (35.68/20.29) LEFVQCLANPNYLNFLaQRGYFK
69- 84 (21.94/ 7.96) LKYLLYWKEPEYAKYL.......
85- 102 (30.20/13.29) .KYPMCL...YFLDLL.QYEHFR
---------------------------------------------------------------------------
|