<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06999
Description |
Cyclin-C |
Sequence | MAGNFWQSSHHQQWLLDKQDLIRERQHDLSVLTEEEYQKIFIFFSSMIQMIGEQLKLRQQVVATATVYFKRFYARNSLKCIDPLLLAPTTVFLASKVEEFGVISNSRLISTMGNVIKNKFSYAYSQEFPYRTNHILECEFYLLEHLDCCLIVYQPYRPLLTLIQDVGPDDQLLMLAWRIINDSLRTDVCLLYPPYQIAIGCLQIACVILQKDLKSWFAELNADMEKIQEIARYIINLYELWKKYDEKNEMPAILAKMPKPKAAPQR |
Length | 266 |
Position | Kinase |
Organism | Trachymyrmex zeteki |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Hymenoptera> Apocrita> Aculeata> Formicoidea>
Formicidae> Myrmicinae> Trachymyrmex.
|
Aromaticity | 0.12 |
Grand average of hydropathy | -0.092 |
Instability index | 51.00 |
Isoelectric point | 6.53 |
Molecular weight | 31261.14 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP06999
No repeats found
|